DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG13590

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:152 Identity:45/152 - (29%)
Similarity:72/152 - (47%) Gaps:17/152 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVNIKCTCYEKSFCELKRCELKVLGRGIVGLFLHA----QAHQLPINSSTCILSLYRRFNGYRPF 70
            :.|..|..|.||:..:..|.||...|....|.::.    .|..:.::..|     .::.|||:||
  Fly    27 MTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVEPARNISVHFKT-----MKKANGYKPF 86

  Fly    71 LYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLND--NMIVKVPFPS 133
            |::.|.|.|.|.: |:..|...:::..|:|.|.:||:||:.     ...:|:|  .:.:.||.||
  Fly    87 LFDYTFDACEFMR-RRNQPVAKIIWYMIRNVSTINHTCPYE-----GLQMLSDFHKVDIPVPLPS 145

  Fly   134 GFYKLMFILKTDGIWRGEVEVY 155
            |.|.||.....||..:....||
  Fly   146 GDYLLMVDWLFDGKTQFATNVY 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 27/79 (34%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 31/91 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472505
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.