DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33919

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:137 Identity:34/137 - (24%)
Similarity:68/137 - (49%) Gaps:18/137 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ELKRCELKVLGRGIVGLFLHAQAHQ-------------LPINSSTCILSLYRR--FNGYRPFLYN 73
            :||:.|..|....:..:..|.:|..             :|:::....:.::.:  .|.|:|||.:
  Fly    25 KLKKIECLVNRTRVSNVSCHVKAINWNLAVVNMDCFMIVPLHNPIIRMQVFTKDYSNQYKPFLVD 89

  Fly    74 MTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPFPSGFYKL 138
            :.:.||...:.|...|:..:::...|.::|||||||.:..:|.....|:.:::  .|||.|||::
  Fly    90 VKIRICEVIERRNFIPYGVIMWKLFKRYTNVNHSCPFSGHLIARDGFLDTSLL--PPFPQGFYQV 152

  Fly   139 MFILKTD 145
            ..:: ||
  Fly   153 SLVV-TD 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 25/79 (32%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 25/83 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472506
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.