powered by:
Protein Alignment CG33783 and CG33771
DIOPT Version :9
Sequence 1: | NP_001027168.1 |
Gene: | CG33783 / 3771958 |
FlyBaseID: | FBgn0053783 |
Length: | 164 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001027145.3 |
Gene: | CG33771 / 3772424 |
FlyBaseID: | FBgn0053771 |
Length: | 178 |
Species: | Drosophila melanogaster |
Alignment Length: | 49 |
Identity: | 13/49 - (26%) |
Similarity: | 22/49 - (44%) |
Gaps: | 7/49 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 71 LYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCP------HNHD 113
:::...|:|:...:.|...|.....|..|| ||..::|| :.||
Fly 84 MFSQKSDVCAVTSSVKNSLFKSWFKDMSKN-SNFMYNCPVEVGHYYMHD 131
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33783 | NP_001027168.1 |
DUF1091 |
60..138 |
CDD:284008 |
13/49 (27%) |
CG33771 | NP_001027145.3 |
DM8 |
80..171 |
CDD:214778 |
13/49 (27%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C45447912 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.