DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33627

DIOPT Version :10

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027406.1 Gene:CG33627 / 3772219 FlyBaseID:FBgn0053627 Length:183 Species:Drosophila melanogaster


Alignment Length:75 Identity:21/75 - (28%)
Similarity:31/75 - (41%) Gaps:16/75 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 NMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNH--SCPHNHDIIVNRMVLNDNMIVKVPFPSGF 135
            ::.||||.|.|....:.|:.:|   ||.|.....  .|||...:.|   ..|.|:...:|     
  Fly    89 DVNVDICQFAKGIHGHRFMTIV---IKAFGKQGSQLKCPHTKGLYV---YPNINIAENLP----- 142

  Fly   136 YKLMFILKTD 145
               .|:.:||
  Fly   143 ---AFLPETD 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:461928 18/66 (27%)
CG33627NP_001027406.1 DUF1091 71..152 CDD:461928 21/75 (28%)

Return to query results.
Submit another query.