DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33643

DIOPT Version :10

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:100 Identity:28/100 - (28%)
Similarity:41/100 - (41%) Gaps:25/100 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 RFNGYRPFLYNMTVDIC----SFFKNRKRYPFVDLVYDAIKNFSNVNHSCP--HNHDIIVNRMVL 121
            |.||....||...:|.|    |..|||    .|::.....|.||||  .||  .|.:..:..:.:
  Fly    79 RPNGQEMKLYEGRLDACLLLGSIQKNR----LVNIYSKTFKRFSNV--ECPLKANFNYTMKNLYM 137

  Fly   122 NDNMIVKVPFPSGFYKLMFILKTDGIWRGEVEVYV 156
            ::.     .|||      |:  ..|.:|..:|.|:
  Fly   138 DEQ-----DFPS------FV--PSGTFRSLIEFYL 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:461928 23/80 (29%)
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 25/91 (27%)

Return to query results.
Submit another query.