DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33702

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster


Alignment Length:148 Identity:52/148 - (35%)
Similarity:82/148 - (55%) Gaps:4/148 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NIKCTCYEKSFCELKRCELKVLGRGIVGLFLH-AQAHQLPINSSTCILSLYRRFNGYRPFLYNMT 75
            |.||...:..|..:|.|.||::.|.:||:..| |..:..|||.....||::|:.|.||.||.|.|
  Fly    28 NFKCISLDPEFAVVKECILKMVRRSVVGINFHIAIKYSQPINKIEFNLSIFRKSNMYRLFLVNHT 92

  Fly    76 VDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNH-DIIVNRMVLNDNMIVKVP--FPSGFYK 137
            :|.|.:.:..::||...:.:|::...:|.|||||:.. ||.|.:|..||..:..:.  .|.|.||
  Fly    93 IDFCYYMRRPEQYPIFYMFHDSLMAATNANHSCPYTEKDIYVKKMTFNDKTLKDLLSFLPVGEYK 157

  Fly   138 LMFILKTDGIWRGEVEVY 155
            |:..:...|:||.:|.::
  Fly   158 LVVSVGAFGVWRLQVNLF 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 28/80 (35%)
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 30/84 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471976
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.