DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33927

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027147.1 Gene:CG33927 / 3771851 FlyBaseID:FBgn0053927 Length:182 Species:Drosophila melanogaster


Alignment Length:150 Identity:39/150 - (26%)
Similarity:72/150 - (48%) Gaps:34/150 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NIKCTCYEKSFCELKRCELKVLGRGIVGLF-------------LHAQAHQLPINSSTCILSLYRR 63
            |..|....:::..:.:|.||.:.||...|.             :|.|              :::|
  Fly    32 NFVCDSVNETWLAVHQCRLKAIRRGTTTLSFNGTVLKTISKFRVHGQ--------------IFKR 82

  Fly    64 FNGYRPFLYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDI-IVNRMVLNDNMIV 127
            .||::|:|||:|.|.|.|.:.....|.: :|::.:|:|||:|.:||:...: |:...::.:.  :
  Fly    83 ANGFKPWLYNITFDGCRFLRKPYEAPVI-IVFNLLKSFSNLNFTCPYMGPVHIMGLHIIGEQ--I 144

  Fly   128 KVPFPSGFYKLM---FILKT 144
            .||.|:|.|.:.   :|.||
  Fly   145 PVPLPTGEYLIQIKWYISKT 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 26/78 (33%)
CG33927NP_001027147.1 DUF1091 75..155 CDD:284008 28/96 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472499
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.