DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33689

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:150 Identity:48/150 - (32%)
Similarity:82/150 - (54%) Gaps:4/150 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NIKCTCYEKSFCELKRCELKVLGRGIVGLFLHAQAHQLPINSSTCILSLYRRFNGYRPFLYNMTV 76
            ||||...:.:|...|:|.:|.:.|....:.::...::|||::.|....|.|..:||:||..:.|.
  Fly    25 NIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDYTF 89

  Fly    77 DICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRM---VLNDNMIVKVPFPSGFYKL 138
            |.|.|.:|:| :|.:.|.|...:..||:||:||::|||||:.:   .:..:.:..:|..:|.|.:
  Fly    90 DGCKFLRNQK-HPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYAV 153

  Fly   139 MFILKTDGIWRGEVEVYVEV 158
            .....||.|.|..:.:|..|
  Fly   154 YSNWSTDNIMRAYLNLYFRV 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 29/80 (36%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 29/80 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.010

Return to query results.
Submit another query.