DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33703

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001027119.1 Gene:CG33703 / 3771760 FlyBaseID:FBgn0053703 Length:181 Species:Drosophila melanogaster


Alignment Length:149 Identity:40/149 - (26%)
Similarity:70/149 - (46%) Gaps:5/149 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 VVNIKCTCYEKSFCELKRCELKVLGRGIVGLFL-HAQAHQLPINSSTCILSLYRRFNGYRPFLYN 73
            |..::|...:.||...|.|::.....|...|:: ....::.||:.....|.::|.....|....|
  Fly    26 VSKMECRSLDPSFTYFKTCKVVRRENGRAALYVSEVFLYKDPIDDIVLNLGVFRIAKNRRFQFLN 90

  Fly    74 MTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPFPSGFYKL 138
            .|:|.|.|.:......|...:...:...||:|.:||...:|..|...:::|.|.::|.|:|.|  
  Fly    91 ETLDYCLFSRQYLASGFFGFLMTPLLRISNLNATCPLQQNITFNGFSVDENTIKEIPIPNGVY-- 153

  Fly   139 MFILKTDGI--WRGEVEVY 155
            ||.|::..:  ||.:|:||
  Fly   154 MFHLRSSLMKKWRTDVKVY 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 21/77 (27%)
CG33703NP_001027119.1 DUF1091 73..155 CDD:284008 22/83 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.