powered by:
Protein Alignment CG33783 and CG14492
DIOPT Version :9
Sequence 1: | NP_001027168.1 |
Gene: | CG33783 / 3771958 |
FlyBaseID: | FBgn0053783 |
Length: | 164 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_611275.2 |
Gene: | CG14492 / 37045 |
FlyBaseID: | FBgn0034283 |
Length: | 199 |
Species: | Drosophila melanogaster |
Alignment Length: | 68 |
Identity: | 20/68 - (29%) |
Similarity: | 30/68 - (44%) |
Gaps: | 6/68 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 68 RPF----LYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPH--NHDIIVNRMVLNDNMI 126
||. |.|:|.|.|....||.:.|.:.|..:.::.|||....||. |....:....|:.|::
Fly 92 RPLPDFVLLNVTTDGCQLLANRNQVPLMRLGRNIMERFSNFPKQCPFKPNFTYYIRGFRLDLNLV 156
Fly 127 VKV 129
..|
Fly 157 PAV 159
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG33783 | NP_001027168.1 |
DUF1091 |
60..138 |
CDD:284008 |
20/68 (29%) |
CG14492 | NP_611275.2 |
DM8 |
95..186 |
CDD:214778 |
18/65 (28%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR20898 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.