DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33137

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:133 Identity:36/133 - (27%)
Similarity:58/133 - (43%) Gaps:24/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 ELKRCELKVLGRGIVGLFLHAQAHQLPINSSTCILS--------LYR---RF--------NGYRP 69
            :||..|...    :.|...:|..|...||.:..:..        ||.   ||        |.::|
  Fly    15 KLKNIECST----VPGFSANASCHIRAINWNKAVAEMDVYLLRPLYNITIRFQILKKDYSNKFQP 75

  Fly    70 FLYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPFPSG 134
            ||.::.:::|.....|...|:..::....:.|||.|||||:...::.....||::.:..| ||.|
  Fly    76 FLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARGAYLNESYLPNV-FPLG 139

  Fly   135 FYK 137
            |||
  Fly   140 FYK 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 28/89 (31%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 23/71 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472500
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.840

Return to query results.
Submit another query.