DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG13193

DIOPT Version :10

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:158 Identity:34/158 - (21%)
Similarity:61/158 - (38%) Gaps:52/158 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KFKTNPIGVVNIKCTCYEKSFCELKRCELKVLGRGIVGLFLHA-QAHQLPINSSTCILSLYRRFN 65
            || ||    ::::|:   |.:|...|..|  ..:|.:.|.:|. :..:..:.::..:|.|....:
  Fly    36 KF-TN----ISVECS---KDYCSSIRGWL--TAKGELNLDIHLNRTLKNGLRTTITLLQLIDGKD 90

  Fly    66 GYRPFLYNMTVDICS-------------FFKNRKRY-------PFVDLVYDAIKNFSNVNHSCPH 110
            .|:. |::..:|.|.             :.:|..:|       |.....|| ::||...|||.|.
  Fly    91 RYQT-LFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYD-VRNFQLENHSIPG 153

  Fly   111 NHDIIVNRMVLNDNMIVKVPFPSGFYKL 138
            .                   .|:|||:|
  Fly   154 Y-------------------LPAGFYRL 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:461928 20/97 (21%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 20/93 (22%)

Return to query results.
Submit another query.