DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG13198

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_610690.1 Gene:CG13198 / 36245 FlyBaseID:FBgn0033640 Length:180 Species:Drosophila melanogaster


Alignment Length:165 Identity:56/165 - (33%)
Similarity:78/165 - (47%) Gaps:21/165 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 TNPIGVVNIKC---------TCYEKSFCELKRCELKVLGRGIVGLFLHAQAHQLPINSSTCILSL 60
            |..:...|:||         |.||       .|.|||:.|..|.|.|.....||||.:.|..|..
  Fly    22 TRLLKFTNVKCMDLPTSRGLTKYE-------YCHLKVVRRNQVELSLKVSLFQLPIRNLTTRLQC 79

  Fly    61 YRRFNGYRPFLYNMTVDICSFFKNRK-RYPFVDLVYDAIKNFSNVNHSCP--HNHDIIVNRMVLN 122
            ::|.:|||||:|.:..|.|....:|. ...|...::|||:..||.|.:||  .|| :.|.:..| 
  Fly    80 FQRRDGYRPFMYYILFDFCKLMASRNYDLSFERFIFDAIRKQSNFNQTCPWKENH-MTVEKFAL- 142

  Fly   123 DNMIVKVPFPSGFYKLMFILKTDGIWRGEVEVYVE 157
            |...:.:|.|:|.|:|.|.....||.|...:|:.|
  Fly   143 DFTKISMPVPAGTYRLGFTFYAYGIARTLTQVFFE 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 28/80 (35%)
CG13198NP_610690.1 DM8 86..179 CDD:214778 33/94 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472237
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.