DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33454

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:160 Identity:57/160 - (35%)
Similarity:86/160 - (53%) Gaps:24/160 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IGVVNIKCTCYEKSFCELKRCELKVLGRGIVGL-----FLHAQAHQLPINSSTCILSLYRRFNGY 67
            :.:.|:.|..|:||......|.||...|....|     |||      ||||.:....:.:|.|||
  Fly    25 VKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLH------PINSISVRFQMLKRANGY 83

  Fly    68 RPFLYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHNHDIIVNRMVLND--NMIVKVP 130
            :|||:::|||.|.|.: :...|.:.:||:.||:.||:|||||:      ..:||||  .:.:.:|
  Fly    84 KPFLFDITVDACQFLR-KPNNPVIKIVYNMIKDASNINHSCPY------GTVVLNDFHRISLPLP 141

  Fly   131 FPSGFYKLMFILKTDGIWRGEVEVYVEVNL 160
            ||||.|    :.:.|.:..|:.:.||.||:
  Fly   142 FPSGDY----LSRLDFLINGKTKFYVNVNM 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 34/79 (43%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 34/86 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472501
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.