DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33467

DIOPT Version :9

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_001286440.1 Gene:CG33467 / 2768834 FlyBaseID:FBgn0053467 Length:188 Species:Drosophila melanogaster


Alignment Length:131 Identity:31/131 - (23%)
Similarity:59/131 - (45%) Gaps:26/131 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 PINSSTCILSL--YRRF-----------------NGYRPFLYNMTVDICSFFKNRKRYPFVDLVY 95
            |||.:|.:::|  |..:                 |.|:|||.:.|..:|...:.:...|:..:|:
  Fly    47 PINWNTALVNLDCYLIYPLINPTIRVQVFMKDYSNQYKPFLIDATFKLCDVVERKNFLPYAVMVW 111

  Fly    96 DAIKNFSNVNHSCPHNHDIIVNRMVLNDNMIVKVPFPSGFYKLMFIL----KTDGIWRGEVEVYV 156
            :..:.|:||. ||..:..:......||.:.:  .|||.|.|::..:.    .|:..:.|.|:.:|
  Fly   112 ELFQRFTNVK-SCHISGQLSARNGYLNSSYV--PPFPHGQYQISVMFSDSNSTNREFVGIVKFFV 173

  Fly   157 E 157
            :
  Fly   174 Q 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:284008 23/96 (24%)
CG33467NP_001286440.1 DUF1091 70..151 CDD:284008 21/83 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472497
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.