DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33783 and CG33477

DIOPT Version :10

Sequence 1:NP_001027168.1 Gene:CG33783 / 3771958 FlyBaseID:FBgn0053783 Length:164 Species:Drosophila melanogaster
Sequence 2:NP_995797.1 Gene:CG33477 / 2768726 FlyBaseID:FBgn0053477 Length:198 Species:Drosophila melanogaster


Alignment Length:110 Identity:26/110 - (23%)
Similarity:46/110 - (41%) Gaps:32/110 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 HQLPINSSTCILSLYRRFNGYRPFLYNMTVDICSFFKNRKRYPFVDLVYDAIKNFSNVNHSCPHN 111
            |::|   .:.||..:|.......|..|:|:.:....:         ::| .|:||.    .|...
  Fly    70 HRVP---DSKILYTFRVVKLAPAFTINITIKVLKTHR---------IMY-KIENFK----GCEFL 117

  Fly   112 HDIIVNRM--------VLNDNMIVKVPF-PSGFYKLMFILKTDGI 147
            ::.::.:|        |:|.:.. |.|. |:.:|     ||||||
  Fly   118 NNPVIFKMFGESYKTLVVNGSYF-KCPIKPNVYY-----LKTDGI 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33783NP_001027168.1 DUF1091 60..138 CDD:461928 16/86 (19%)
CG33477NP_995797.1 DUF1091 100..171 CDD:461928 18/77 (23%)

Return to query results.
Submit another query.