DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx5 and AHP1

DIOPT Version :9

Sequence 1:NP_001027191.1 Gene:Prx5 / 3771951 FlyBaseID:FBgn0038570 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_013210.1 Gene:AHP1 / 850799 SGDID:S000004099 Length:176 Species:Saccharomyces cerevisiae


Alignment Length:128 Identity:49/128 - (38%)
Similarity:77/128 - (60%) Gaps:6/128 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVMSAWGKEHGA--AGK 126
            |||||.|.|.||:|.|:.:|:|||::..|||..::.||:::.|:|::||...||.|..|.  ...
Yeast    47 KKVIITGAPAAFSPTCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTH 111

  Fly   127 VRLLADPAGGFTKALDVTIDLPPLGGVR-SKRYSLVVENGKVTELNVEPD-GTGLSCSLANNI 187
            ::..:||...|||:  :..:|....||. |.|:::|||||.||....|.: ||.::.|...::
Yeast   112 IKFASDPGCAFTKS--IGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESV 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx5NP_001027191.1 PRX5_like 37..187 CDD:239311 49/126 (39%)
AhpC-TSA 37..169 CDD:278975 44/107 (41%)
AHP1NP_013210.1 AHP1 1..176 CDD:223750 49/128 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343089
Domainoid 1 1.000 84 1.000 Domainoid score I1925
eggNOG 1 0.900 - - E1_COG0678
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I1585
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55675
OrthoFinder 1 1.000 - - FOG0003174
OrthoInspector 1 1.000 - - oto99411
orthoMCL 1 0.900 - - OOG6_101112
Panther 1 1.100 - - LDO PTHR10430
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R937
SonicParanoid 1 1.000 - - X2138
TreeFam 1 0.960 - -
1312.790

Return to query results.
Submit another query.