DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx5 and AT1G65990

DIOPT Version :9

Sequence 1:NP_001027191.1 Gene:Prx5 / 3771951 FlyBaseID:FBgn0038570 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_176774.1 Gene:AT1G65990 / 842912 AraportID:AT1G65990 Length:553 Species:Arabidopsis thaliana


Alignment Length:156 Identity:63/156 - (40%)
Similarity:99/156 - (63%) Gaps:14/156 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AMVKVGDSLP--SVDLF-EDSPANKINTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADEL 94
            |.:.|||.:|  |:..| :|.....::...|..|||||:|||||||.|.||..|:.|::..|:||
plant     2 APIDVGDFVPDGSISFFDDDDQLQTVSVHSLAAGKKVILFGVPGAFPPTCSMNHVNGFIEKAEEL 66

  Fly    95 KSKQGVDEIVCVSVNDPFVMSAWGK-EHGAAGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSKR 157
            || .|||||:|:|.:|||:::|..: :|     |:.:.|.:|.:.:.|.:.:::...| ||||:.
plant    67 KS-NGVDEIICLSGDDPFMITACSENKH-----VKFVEDGSGEYIQLLGLELEVKDKGLGVRSRG 125

  Fly   158 YSLVVENGKVTELNVEPDGTGLSCSL 183
            ::|:::|.||..:||   |:|..|||
plant   126 FALLLDNLKVIVVNV---GSGGDCSL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx5NP_001027191.1 PRX5_like 37..187 CDD:239311 62/152 (41%)
AhpC-TSA 37..169 CDD:278975 55/136 (40%)
AT1G65990NP_176774.1 PRX5_like 6..140 CDD:239311 55/139 (40%)
F-box 158..203 CDD:366220
FBA_1 366..532 CDD:254394
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1591
eggNOG 1 0.900 - - E1_COG0678
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10430
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.