DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx5 and TPX1

DIOPT Version :9

Sequence 1:NP_001027191.1 Gene:Prx5 / 3771951 FlyBaseID:FBgn0038570 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_176773.1 Gene:TPX1 / 842910 AraportID:AT1G65980 Length:162 Species:Arabidopsis thaliana


Alignment Length:163 Identity:77/163 - (47%)
Similarity:110/163 - (67%) Gaps:10/163 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AMVKVGDSLP--SVDLFEDSPANKINTG---DLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSAD 92
            |.:.|||.:|  ::..|:::  :::.|.   .|..|||||:|||||||||.||..|:||::..|:
plant     2 APIAVGDVVPDGTISFFDEN--DQLQTASVHSLAAGKKVILFGVPGAFTPTCSMKHVPGFIEKAE 64

  Fly    93 ELKSKQGVDEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSK 156
            ||||| |||||:|.||||||||.||||.:.....|:.:||.:|.:|..|.:.:||...| ||||:
plant    65 ELKSK-GVDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGLGVRSR 128

  Fly   157 RYSLVVENGKVTELNVEPDGTGLSCSLANNIGK 189
            |::|::::.|||..|||..|. .:.|.|::|.|
plant   129 RFALLLDDLKVTVANVESGGE-FTVSSADDILK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx5NP_001027191.1 PRX5_like 37..187 CDD:239311 74/155 (48%)
AhpC-TSA 37..169 CDD:278975 67/137 (49%)
TPX1NP_176773.1 PRX5_like 6..160 CDD:239311 75/157 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1591
eggNOG 1 0.900 - - E1_COG0678
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8076
Inparanoid 1 1.050 138 1.000 Inparanoid score I1809
OMA 1 1.010 - - QHG55675
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003174
OrthoInspector 1 1.000 - - otm3197
orthoMCL 1 0.900 - - OOG6_101112
Panther 1 1.100 - - O PTHR10430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.