DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx5 and TPX2

DIOPT Version :9

Sequence 1:NP_001027191.1 Gene:Prx5 / 3771951 FlyBaseID:FBgn0038570 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_176772.1 Gene:TPX2 / 842909 AraportID:AT1G65970 Length:162 Species:Arabidopsis thaliana


Alignment Length:161 Identity:75/161 - (46%)
Similarity:107/161 - (66%) Gaps:6/161 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 AMVKVGDSLP--SVDLF-EDSPANKINTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADEL 94
            |.:.|||.:|  ::..| |:.....::...:..|||||:|||||||||.||.:|:||::..|:||
plant     2 APITVGDVVPDGTISFFDENDQLQTVSVHSIAAGKKVILFGVPGAFTPTCSMSHVPGFIGKAEEL 66

  Fly    95 KSKQGVDEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKALDVTIDLPPLG-GVRSKRY 158
            ||| |:|||:|.||||||||.||||.:.....|:.:||.:|.:|..|.:.:||...| |:||:|:
plant    67 KSK-GIDEIICFSVNDPFVMKAWGKTYPENKHVKFVADGSGEYTHLLGLELDLKDKGLGIRSRRF 130

  Fly   159 SLVVENGKVTELNVEPDGTGLSCSLANNIGK 189
            :|:::|.|||..|||..|. .:.|.|.:|.|
plant   131 ALLLDNLKVTVANVESGGE-FTVSSAEDILK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx5NP_001027191.1 PRX5_like 37..187 CDD:239311 72/153 (47%)
AhpC-TSA 37..169 CDD:278975 65/135 (48%)
TPX2NP_176772.1 PRX5_like 6..160 CDD:239311 73/155 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1591
eggNOG 1 0.900 - - E1_COG0678
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8076
Inparanoid 1 1.050 138 1.000 Inparanoid score I1809
OMA 1 1.010 - - QHG55675
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003174
OrthoInspector 1 1.000 - - otm3197
orthoMCL 1 0.900 - - OOG6_101112
Panther 1 1.100 - - O PTHR10430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.