DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx5 and PRXIIF

DIOPT Version :9

Sequence 1:NP_001027191.1 Gene:Prx5 / 3771951 FlyBaseID:FBgn0038570 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_566268.1 Gene:PRXIIF / 819778 AraportID:AT3G06050 Length:201 Species:Arabidopsis thaliana


Alignment Length:185 Identity:73/185 - (39%)
Similarity:108/185 - (58%) Gaps:16/185 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRVLSCKFLGRVVNSALPQQI-ISLRSLSK-------TSAAMVKVGDSLPSVDLFEDSPANKINT 57
            |.:|..:.|..:.::|...:| :|.|..||       ||||   .|.||.....:::..::|.:|
plant     3 MSILKLRNLSALRSAANSARIGVSSRGFSKLAEGTDITSAA---PGVSLQKARSWDEGVSSKFST 64

  Fly    58 ---GDLVNGKKVIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVDEIVCVSVNDPFVMSAWGK 119
               .|:..||||:|||:|||:|..||:.|:|.|.|..|:.|:| |:|.::||||||||.::.|.:
plant    65 TPLSDIFKGKKVVIFGLPGAYTGVCSQQHVPSYKSHIDKFKAK-GIDSVICVSVNDPFAINGWAE 128

  Fly   120 EHGAAGKVRLLADPAGGFTKALDVTIDL-PPLGGVRSKRYSLVVENGKVTELNVE 173
            :.||...:....|..|.|.|:|.:..|| ..|.|.||:|:|..||:|||..:|||
plant   129 KLGAKDAIEFYGDFDGKFHKSLGLDKDLSAALLGPRSERWSAYVEDGKVKAVNVE 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx5NP_001027191.1 PRX5_like 37..187 CDD:239311 60/141 (43%)
AhpC-TSA 37..169 CDD:278975 57/135 (42%)
PRXIIFNP_566268.1 PRX5_like 67..198 CDD:239311 55/118 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0678
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003174
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101112
Panther 1 1.100 - - O PTHR10430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2138
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.770

Return to query results.
Submit another query.