DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx5 and SPBC1773.02c

DIOPT Version :9

Sequence 1:NP_001027191.1 Gene:Prx5 / 3771951 FlyBaseID:FBgn0038570 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_595117.1 Gene:SPBC1773.02c / 2539615 PomBaseID:SPBC1773.02c Length:195 Species:Schizosaccharomyces pombe


Alignment Length:179 Identity:49/179 - (27%)
Similarity:78/179 - (43%) Gaps:23/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VLSCKFLGRVVNSALPQQIISLRSLSKTSA--AMVKVGDSLPSVDLFEDSPANKINTGDLVNGKK 65
            ||..|  |.::..|.|   :.|:..:|..:  :.::|||.:|.:.| .|.....|...|:...|.
pombe    17 VLDSK--GTIIPEAAP---VMLKKPAKDESVDSTIQVGDVIPDITL-PDEDGTSIRLRDITANKG 75

  Fly    66 VIIFGVPGAFTPGCSKTHLPGYVSSADELKSKQGVD-EIVCVSVNDPFVMSAWGKEHGAAGKVRL 129
            ::||..|.|.||||:|... |:   .|.....|..| |::.:|.:......|:..:...  ...|
pombe    76 LVIFAYPKASTPGCTKQGC-GF---RDNYPKIQASDYEVLGLSFDTSKAQKAFKDKQNF--PYHL 134

  Fly   130 LADPAGGFTKALDVTIDLPPLGGVRSKRYSLVVENGK----VTELNVEP 174
            |:||.|...|.|..  :.|  ||.:..|...:.|.|.    |.|:::.|
pombe   135 LSDPKGELIKKLGA--EKP--GGGKLFRSHWIFEKGTGKCIVKEIDISP 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx5NP_001027191.1 PRX5_like 37..187 CDD:239311 41/143 (29%)
AhpC-TSA 37..169 CDD:278975 39/136 (29%)
SPBC1773.02cNP_595117.1 Bcp 45..192 CDD:224146 41/146 (28%)
AhpC-TSA 48..175 CDD:278975 39/137 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.