DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prx5 and Prdx5

DIOPT Version :9

Sequence 1:NP_001027191.1 Gene:Prx5 / 3771951 FlyBaseID:FBgn0038570 Length:190 Species:Drosophila melanogaster
Sequence 2:NP_446062.1 Gene:Prdx5 / 113898 RGDID:71007 Length:213 Species:Rattus norvegicus


Alignment Length:168 Identity:91/168 - (54%)
Similarity:116/168 - (69%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 RSLSKTSAAM--VKVGDSLPSVDLFEDSPANKINTGDLVNGKKVIIFGVPGAFTPGCSKTHLPGY 87
            ||.|..:..|  :||||::|||::||..|..|:|..:|...||.::||||||||||||||||||:
  Rat    43 RSFSSAAVTMAPIKVGDTIPSVEVFEGEPGKKVNLAELFKDKKGVLFGVPGAFTPGCSKTHLPGF 107

  Fly    88 VSSADELKSKQGVDEIVCVSVNDPFVMSAWGKEHGAAGKVRLLADPAGGFTKALDVTID---LPP 149
            |..|..||:| |...:.|:||||.||.:.||:.|.|.|||:|||||.|.|.|..|:.:|   :..
  Rat   108 VEQAGALKAK-GAQVVACLSVNDAFVTAEWGRAHQAEGKVQLLADPTGAFGKETDLLLDDSLVSL 171

  Fly   150 LGGVRSKRYSLVVENGKVTELNVEPDGTGLSCSLANNI 187
            .|..|.||:|:|::.|.|..||||||||||:||||.||
  Rat   172 FGNRRLKRFSMVIDKGVVKALNVEPDGTGLTCSLAPNI 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prx5NP_001027191.1 PRX5_like 37..187 CDD:239311 84/152 (55%)
AhpC-TSA 37..169 CDD:278975 70/134 (52%)
Prdx5NP_446062.1 PRX5_like 57..211 CDD:239311 86/154 (56%)
Microbody targeting signal. /evidence=ECO:0000250|UniProtKB:P30044 211..213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338614
Domainoid 1 1.000 163 1.000 Domainoid score I3884
eggNOG 1 0.900 - - E1_COG0678
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H8076
Inparanoid 1 1.050 182 1.000 Inparanoid score I3881
OMA 1 1.010 - - QHG55675
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003174
OrthoInspector 1 1.000 - - oto96587
orthoMCL 1 0.900 - - OOG6_101112
Panther 1 1.100 - - LDO PTHR10430
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2138
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.760

Return to query results.
Submit another query.