DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13175 and Lto1

DIOPT Version :9

Sequence 1:NP_610740.1 Gene:CG13175 / 3771946 FlyBaseID:FBgn0033693 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001101035.1 Gene:Lto1 / 309136 RGDID:1304637 Length:222 Species:Rattus norvegicus


Alignment Length:112 Identity:32/112 - (28%)
Similarity:53/112 - (47%) Gaps:10/112 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GYEEGLKDGQEQGNEEGYKLGYAQGVSLGEELGKILGQVVAQQQLKHT---DKVRRSL---EQLR 84
            ||:||.::|...|..||.:.|...|..:|.|:|...|..:|.:.|.|:   :|..|.:   |.|.
  Rat   107 GYQEGYEEGSSLGIVEGKQYGVLHGAKIGSEIGCYRGFALAWKCLLHSGAGEKESRKMKVVEALI 171

  Fly    85 SLIEEFPRTNDPQADIVGAVQDIRSSHRR----LRAQLGSKKTPGAA 127
            :|:::||..:.....:...::.||...|:    |..|...|.|.|.:
  Rat   172 TLLQDFPYDDPTYEKLHEDLERIRGKFRQLCSLLNVQPDFKVTAGGS 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13175NP_610740.1 Yae1_N 26..64 CDD:286849 14/37 (38%)
Lto1NP_001101035.1 Yae1_N 107..145 CDD:286849 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4595
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG55489
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104693
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.