DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13175 and SPCC191.08

DIOPT Version :9

Sequence 1:NP_610740.1 Gene:CG13175 / 3771946 FlyBaseID:FBgn0033693 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_588297.1 Gene:SPCC191.08 / 2539204 PomBaseID:SPCC191.08 Length:134 Species:Schizosaccharomyces pombe


Alignment Length:121 Identity:36/121 - (29%)
Similarity:60/121 - (49%) Gaps:8/121 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 FDDIVLTEEKEARLGYEEGLKDGQEQGNEEGYKLGYAQGVSLGEELGKILGQV---VAQQQLKH- 72
            ::::...||.|.:.||:||:..|.|||.||.:..|.....:.....|:|.|:|   :.::..:| 
pombe     3 WEEVTKLEENEYKRGYDEGILKGIEQGYEEAFLFGLEHAYNKYLLAGEIYGRVCFWLKEENSQHP 67

  Fly    73 -TDKVRRSLEQLRSLIEEFPRTNDPQADIVG---AVQDIRSSHRRLRAQLGSKKTP 124
             ..|..|.||||:||:|..|..|:.:....|   ....|.:..:.:.:.||:|..|
pombe    68 KIKKAHRHLEQLKSLLESLPTNNELEETDAGFDSYWNKITAKAKVVSSLLGTKILP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13175NP_610740.1 Yae1_N 26..64 CDD:286849 14/37 (38%)
SPCC191.08NP_588297.1 Yae1_N 17..55 CDD:286849 14/37 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2049
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto101710
orthoMCL 1 0.900 - - OOG6_104693
Panther 1 1.100 - - LDO PTHR28532
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4868
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.850

Return to query results.
Submit another query.