DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13175 and lto1

DIOPT Version :9

Sequence 1:NP_610740.1 Gene:CG13175 / 3771946 FlyBaseID:FBgn0033693 Length:141 Species:Drosophila melanogaster
Sequence 2:NP_001123700.1 Gene:lto1 / 100170452 XenbaseID:XB-GENE-5953070 Length:137 Species:Xenopus tropicalis


Alignment Length:114 Identity:39/114 - (34%)
Similarity:55/114 - (48%) Gaps:13/114 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 NDLFDDIVLTEEKEARLGYEEGLKDGQEQGNEEGYKLGYAQGVSLGEELGKILGQVVAQQQL--- 70
            :||||||::.|::....||||||.:|...|..||.:.|...|..:|.|||..||.....:.|   
 Frog     5 DDLFDDIIMCEQRYRGEGYEEGLAEGNSAGESEGKQYGAVYGARMGSELGCYLGFASTWRLLLVP 69

  Fly    71 KHTDKVRRSLEQLRSLIEEF----------PRTNDPQADIVGAVQDIRS 109
            ...|:.||.::.|.|||...          |...:..|:|.|.|:.:.|
 Frog    70 ASDDRQRRKIKALDSLIAMIRNFHSDDPTNPNLQEDMANIRGKVKQVCS 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13175NP_610740.1 Yae1_N 26..64 CDD:286849 18/37 (49%)
lto1NP_001123700.1 Yae1_N 22..60 CDD:370714 18/37 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5225
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto104643
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.