DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG14518

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:155 Identity:54/155 - (34%)
Similarity:84/155 - (54%) Gaps:8/155 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 VICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVKINIATFQRLNGYK 84
            ||.|:  ||..|.|.:..:..|..|.|::|:|.....::...||. ||.:|.:.....:|.||||
  Fly    23 VIFKM--TNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLH-PVHDVIVKARLLKRANGYK 84

  Fly    85 PFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIILDKVSISHANTQVTNVLP 149
            |:||:|:.|||:|.: :|:|.:....:..||:||.|||:|||   :.|.:|...:..::.... |
  Fly    85 PWLYSVSFDGCQFIR-RRNNALIRIVWELFKEYSTINHTCPY---VGLQQVKNFYLRSEKLPT-P 144

  Fly   150 VPHGNYLYRADWYAYNIKRATVDVY 174
            :|.|.||...||......:|..:||
  Fly   145 IPTGEYLLMIDWVFNKKPQAATNVY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 30/83 (36%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 34/92 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472491
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.