DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG13250

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649245.1 Gene:CG13250 / 40284 FlyBaseID:FBgn0037013 Length:192 Species:Drosophila melanogaster


Alignment Length:105 Identity:20/105 - (19%)
Similarity:44/105 - (41%) Gaps:3/105 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 LEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVKINIATFQRLNGY-KPF- 86
            :.:.:|.|..:||..|....|.:..:.:....:.....||:..|:.:.:.::..|..|.. :|. 
  Fly    33 IRWRDINCSVIDPTTAEIFKCDIVEMPKKQGNFLNTFLLLRRSVTKMWVELSVGQIANRKDRPVQ 97

  Fly    87 -LYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCP 125
             |:.:.||||...:.:..:.:.:...:......|...:||
  Fly    98 QLFKIRVDGCHLIEFRSKSRILNAVLHKLLQSGNYPDACP 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 11/57 (19%)
CG13250NP_649245.1 DM8 95..181 CDD:214778 9/43 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472646
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.