DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG13590

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611919.1 Gene:CG13590 / 37907 FlyBaseID:FBgn0035012 Length:193 Species:Drosophila melanogaster


Alignment Length:170 Identity:52/170 - (30%)
Similarity:89/170 - (52%) Gaps:23/170 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFLFTIHLVIC--------KLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVS 68
            :|:|.:.|::.        .|:.||..|.:.:..:.|.|||.||:.:|.....::.|..:: |..
  Fly     5 VFIFAVSLLVAYLSCGEAPYLKMTNAVCKSYNKSWVVVHYCRLKAYSRAKTSLNINVTFVE-PAR 68

  Fly    69 NVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIILD 133
            |:.::..|.::.|||||||::.|.|.|.|.: :|:.||....:...::.|.|||:|||:.   |.
  Fly    69 NISVHFKTMKKANGYKPFLFDYTFDACEFMR-RRNQPVAKIIWYMIRNVSTINHTCPYEG---LQ 129

  Fly   134 KVSISHANTQVTNVLPVPHGNYLYRADW-------YAYNI 166
            .:|..|   :|...:|:|.|:||...||       :|.|:
  Fly   130 MLSDFH---KVDIPVPLPSGDYLLMVDWLFDGKTQFATNV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 29/83 (35%)
CG13590NP_611919.1 DM8 83..171 CDD:214778 32/91 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472492
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.