DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33640

DIOPT Version :10

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027255.2 Gene:CG33640 / 3772680 FlyBaseID:FBgn0053640 Length:178 Species:Drosophila melanogaster


Alignment Length:39 Identity:10/39 - (25%)
Similarity:16/39 - (41%) Gaps:0/39 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 LYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCP 125
            ||||.::.|....:...|......:|.:..:.|....||
  Fly    86 LYNVQLNFCSVLNNGYKNKFIRMLYNNYAQFLNTKPKCP 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 10/39 (26%)
CG33640NP_001027255.2 DUF1091 73..154 CDD:461928 10/39 (26%)

Return to query results.
Submit another query.