DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33725

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027125.1 Gene:CG33725 / 3772600 FlyBaseID:FBgn0053725 Length:181 Species:Drosophila melanogaster


Alignment Length:179 Identity:58/179 - (32%)
Similarity:91/179 - (50%) Gaps:23/179 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 SIFLFTIHLVICKL------EFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSN 69
            ||....:.:::..|      :|||..|::.:..:.|||.|.||:|:|.....:....:|. |.:|
  Fly     8 SILCVAVGILVIDLNDAVVFKFTNFACLSRNQSWFVFHNCRLKAVSREKVLLNFNGTVLH-PANN 71

  Fly    70 VKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSN--PVFSYFFNFFKDYSNINHSCPYDHDIIL 132
            :.:::..|::.||:||:|.:|.:|.|||.   |:|  |.....|:.|||:|.|||:|||   :.|
  Fly    72 IIVHVKLFKKANGFKPWLLDVKLDACRFV---RTNFHPFVRIIFDLFKDFSTINHTCPY---VGL 130

  Fly   133 DKVSISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVD-----VYAK 176
            ..|...:...:... ||.|.|:||....|..  .||...|     |||:
  Fly   131 QVVKDFYLRPEKLK-LPFPSGDYLLSLIWIF--DKRPQFDTNVSFVYAE 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 31/85 (36%)
CG33725NP_001027125.1 DUF1091 74..154 CDD:284008 32/86 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472485
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.