DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33644

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027259.1 Gene:CG33644 / 3772563 FlyBaseID:FBgn0053644 Length:158 Species:Drosophila melanogaster


Alignment Length:152 Identity:34/152 - (22%)
Similarity:62/152 - (40%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 TNIKCVTLDPEFAVFHYCFL--KSVNRTYKYYSLKVKLLKTPVSNVKINIATFQRLNGYKPFLYN 89
            |.|:|....||:.....|.|  ||.|...|.:|.:..|.| .|::|: ....|....|.....|.
  Fly     6 TQIECPIHSPEYVQNFSCRLHKKSPNSGSKSFSAEFSLRK-EVNDVR-GAYVFSFKQGKSIINYT 68

  Fly    90 -VTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPY--DHDIILDKVSISHANTQVTNVLPVP 151
             :.:|.|:.....:|..:|....:..:..||...:||:  :....:|:.:|:      ..|:|..
  Fly    69 AMEIDYCQALSALQSQILFKLIADELRRVSNFPLNCPFVMNKRYYVDEFTIN------PKVIPSY 127

  Fly   152 HGNYLYRADWYAYNIKRATVDV 173
            ....::.:|...:..||..:.:
  Fly   128 TPEMIFTSDCNIFIKKRRAMQL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 15/86 (17%)
CG33644NP_001027259.1 DUF1091 50..133 CDD:284008 16/89 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.