DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33769

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027143.1 Gene:CG33769 / 3772499 FlyBaseID:FBgn0053769 Length:179 Species:Drosophila melanogaster


Alignment Length:132 Identity:32/132 - (24%)
Similarity:52/132 - (39%) Gaps:38/132 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 NR-TYKYYSLKVKLLKTPVSNVKINIATFQ-----------RLNGYKPF--LYNVTVDGCRFYKH 100
            || |:..:|  ::::||.|....|.:.|.:           ||...||:  :|...::.|...|.
  Fly    37 NRSTFSNFS--IQIIKTKVIMDMILVTTLRQGLKAHLSFEFRLTKAKPYQSVYQHDMNYCALIKG 99

  Fly   101 QRSNPVFSYFFNFFKDYSNINHSCP------YDHDIILDKVSISHANTQVTNVLPVPHGNYLYRA 159
            .:.: ::..:|.......|...|||      |.|...||      ||.       ||  ::||..
  Fly   100 SQES-IYRRWFTSMLKVGNFATSCPIREGYYYLHGWTLD------ANN-------VP--SFLYLG 148

  Fly   160 DW 161
            |:
  Fly   149 DY 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 22/102 (22%)
CG33769NP_001027143.1 DM8 82..173 CDD:214778 20/85 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448021
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.