DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33792

DIOPT Version :10

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027411.2 Gene:CG33792 / 3772111 FlyBaseID:FBgn0053792 Length:225 Species:Drosophila melanogaster


Alignment Length:120 Identity:32/120 - (26%)
Similarity:57/120 - (47%) Gaps:20/120 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLFTIHLVICKLE---FTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVKINI 74
            :.|.|....|...   |:|:.|:             ||.||.|....::... :|..::::|:::
  Fly    29 YFFKIRKTECIANGAYFSNVSCI-------------LKPVNWTRSVLNMDGD-IKEALTDIKMSV 79

  Fly    75 ATFQR--LNGYKPFLYNVTVDGCRFYKHQ-RSNPVFSYFFNFFKDYSNINHSCPY 126
            ..|.:  .|.||||......|.|:..|:: :||.:..|..:...:::|:||||||
  Fly    80 EVFYKDSSNLYKPFAVKFKFDVCQLLKNKTQSNFLQKYAISHLTEWTNVNHSCPY 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 19/58 (33%)
CG33792NP_001027411.2 DUF1091 82..183 CDD:461928 19/53 (36%)

Return to query results.
Submit another query.