DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33643

DIOPT Version :10

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027258.1 Gene:CG33643 / 3772011 FlyBaseID:FBgn0053643 Length:178 Species:Drosophila melanogaster


Alignment Length:118 Identity:24/118 - (20%)
Similarity:40/118 - (33%) Gaps:37/118 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 YCF--LKSVNRTYKYYSLKVKLLKTPVSNVKI--------------------------------- 72
            |||  |..|:...:.:.:.|..:.|.:.:.|.                                 
  Fly     8 YCFLILYCVDSAQRNFRIVVDHISTKIFDTKTIETLGCQVDQSSNRSYVNCHMLLNREVGKFDAR 72

  Fly    73 NIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCP 125
            |:..|.|.||.:..||...:|.|......:.|.:.:.:...||.:||:  .||
  Fly    73 NVLDFVRPNGQEMKLYEGRLDACLLLGSIQKNRLVNIYSKTFKRFSNV--ECP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 16/87 (18%)
CG33643NP_001027258.1 DUF1091 79..152 CDD:461928 14/47 (30%)

Return to query results.
Submit another query.