DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33796

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:164 Identity:52/164 - (31%)
Similarity:91/164 - (55%) Gaps:16/164 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LVQLSIFLFTI----HLVICKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPV 67
            :|.|:|....|    :.|:.||  ||:.|.:.:..:...:.|.||::||....::.....| .|.
  Fly     8 VVSLTILCLMILKPSNPVVFKL--TNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFL-YPT 69

  Fly    68 SNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIIL 132
            .::.::..||:|.|||:|:|.|..:|||||.: :..:.:....||.:::::||||:||...|:|:
  Fly    70 KSITVHYQTFKRENGYRPWLVNTQIDGCRFLR-KPYDALGILLFNIYRNFTNINHTCPLQGDMIV 133

  Fly   133 DKVSISHANTQVTNV--LPVPHGNYLYRADWYAY 164
            ..:.::      |:|  ||:|.|:||...||..|
  Fly   134 RNMYLT------TDVMRLPLPTGDYLLAIDWIFY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 30/85 (35%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 31/86 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472483
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.990

Return to query results.
Submit another query.