DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33453

DIOPT Version :10

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:168 Identity:60/168 - (35%)
Similarity:98/168 - (58%) Gaps:14/168 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 IFLFTIHLVIC-----KLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTPVSNVK 71
            :||..:.|:..     .::.||:.|.:::..:||||||.||:.:|.....::....|. |.:||.
  Fly    10 VFLAALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH-PTNNVS 73

  Fly    72 INIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDIILDKVS 136
            :.:...:||:||||||::||:|.|:|.: :|.|||...|::|.||||.:||:|||...::.|   
  Fly    74 LRLKMVKRLSGYKPFLFDVTIDACQFLR-KRHNPVIKMFYSFIKDYSTLNHTCPYGLQVVSD--- 134

  Fly   137 ISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVDVY 174
               .:|.|..| |:|.|:|....|:..|..|:..|::|
  Fly   135 ---YHTAVFPV-PLPSGDYGVLLDFIFYAKKQFHVNIY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:461928 35/83 (42%)
CG33453NP_995888.1 DUF1091 78..149 CDD:461928 35/78 (45%)

Return to query results.
Submit another query.