DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33454

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:162 Identity:58/162 - (35%)
Similarity:91/162 - (56%) Gaps:16/162 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ARLVQLSIFLFTIHLVI---CKLEFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTP 66
            |.::.|.:|:..:.||.   ..::.||:.|.:.|....|||||.||:.:||.....:....|. |
  Fly     3 ANVIILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLHINATFLH-P 66

  Fly    67 VSNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDII 131
            ::::.:.....:|.|||||||:::|||.|:|.: :.:|||....:|..||.|||||||||...::
  Fly    67 INSISVRFQMLKRANGYKPFLFDITVDACQFLR-KPNNPVIKIVYNMIKDASNINHSCPYGTVVL 130

  Fly   132 LD--KVSISHANTQVTNVLPVPHGNYLYRADW 161
            .|  ::|:.         ||.|.|:||.|.|:
  Fly   131 NDFHRISLP---------LPFPSGDYLSRLDF 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 34/85 (40%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 34/85 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472488
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.