DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33922 and CG33483

DIOPT Version :9

Sequence 1:NP_001027217.1 Gene:CG33922 / 3771945 FlyBaseID:FBgn0053922 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:173 Identity:83/173 - (47%)
Similarity:121/173 - (69%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RLVQLSIFLFTIHLVICKL----EFTNIKCVTLDPEFAVFHYCFLKSVNRTYKYYSLKVKLLKTP 66
            :.:.:.:.::.|.:...|:    |||||||.:.|..|..|.||.||||||::||.||||.|.|.|
  Fly    53 KYISVKVRMYKIPVTKVKIASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVP 117

  Fly    67 VSNVKINIATFQRLNGYKPFLYNVTVDGCRFYKHQRSNPVFSYFFNFFKDYSNINHSCPYDHDII 131
            ::.||:|.:..:|.|||||||||:|||.|:..:|.:.||:||:|:..||.:||:||:||:|||:|
  Fly   118 ITKVKVNFSLLKRFNGYKPFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLI 182

  Fly   132 LDKVSISHANTQVTNVLPVPHGNYLYRADWYAYNIKRATVDVY 174
            ::|:..:..|.:|...:..|||:||:.:|||||.|.|||||.:
  Fly   183 VEKLPTNFMNQKVNGDIKFPHGDYLFHSDWYAYGINRATVDFF 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33922NP_001027217.1 DUF1091 72..156 CDD:284008 39/83 (47%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 40/84 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472107
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I7527
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.990

Return to query results.
Submit another query.