DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment His4:CG33875 and H4C13

DIOPT Version :10

Sequence 1:NP_001027367.1 Gene:His4:CG33875 / 3771941 FlyBaseID:FBgn0053875 Length:103 Species:Drosophila melanogaster
Sequence 2:NP_003537.1 Gene:H4C13 / 8368 HGNCID:4791 Length:103 Species:Homo sapiens


Alignment Length:122 Identity:28/122 - (22%)
Similarity:50/122 - (40%) Gaps:28/122 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RRRTLTSLITFTVIGGATSSALAQEKW----GTRSFIKEKYFMPGLSPEDAAARIKQTAEGLRDM 103
            :|:.| ||...|.:....|:|:|.|:.    |:...::|       .|.:...::...|    |:
Human   786 KRKNL-SLFDLTTLIHPRSAAIASERHNLSNGSALVVQE-------PPREKQRKVNFVA----DI 838

  Fly   104 REMLDHMSWRYVIFYIRLKQAYLSQDLTNAMNILPESRRNDYVQAANELVENMSELD 160
            :        .:.:|:.|.||....|:.....::..|..|.   |||..|..|: ||:
Human   839 K--------NFGLFHRRSKQNAAEQNANQIFSVSEEITRQ---QAAGALERNI-ELE 883

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
His4:CG33875NP_001027367.1 PLN00035 1..103 CDD:177669 13/63 (21%)
H4C13NP_003537.1 PLN00035 1..103 CDD:177669
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..20
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.