DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cana and KIF3B

DIOPT Version :9

Sequence 1:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster
Sequence 2:NP_004789.1 Gene:KIF3B / 9371 HGNCID:6320 Length:747 Species:Homo sapiens


Alignment Length:670 Identity:190/670 - (28%)
Similarity:302/670 - (45%) Gaps:115/670 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KNASSIQVCIKVRPC---EPGLT---------SLWQVKEGRSIQLADSHAEPYVFDYVFDEGASN 56
            |::.|::|.::.||.   |...:         .|.||........|....:.:.||.|:|..|..
Human     5 KSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFDAVYDWNAKQ 69

  Fly    57 QEVFDRMAKHIVHACMQGSNGTIFAYGQTSSGKTYTM---MGDEQNPGVMVLAAKEIFQQISSET 118
            .|::|...:.:|.:.:||.||||||||||.:||||||   .||.:..||:..:...||..||...
Human    70 FELYDETFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQ 134

  Fly   119 ERDFLLRVGYIEIYNEKIYDLLNK-KNQDLKIHESGNGIVNVNCKESIVT-SEDDLLRQLYMGNK 181
            .:.:|:|..|:|||.|:|.|||:| :.:.|::.|..:..|.|....|.|| |..::...:.:||:
Human   135 NQQYLVRASYLEIYQEEIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQ 199

  Fly   182 ERVVGETNMNERSSRSHAIFRIIIESRKSDHSDNDTVKQSVLSLVDLAGSE-------QVDPADH 239
            .|.||.|||||.||||||||.|.||..:......:.::...|:||||||||       |.:....
Human   200 NRSVGATNMNEHSSRSHAIFVITIECSEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKE 264

  Fly   240 AS----SLMIFRNLVKSLSESVDSKPN--SFRDSKLPRIMLPSLGGNVLTSIICTITPSF--VEE 296
            |:    ||....|::.:|   ||.|..  .:|||||.|::..|||||..|.::..:.|:.  |||
Human   265 ATKINLSLSALGNVISAL---VDGKSTHIPYRDSKLTRLLQDSLGGNAKTVMVANVGPASYNVEE 326

  Fly   297 SSSTISFGTCAKKIRCKPQVCKIDSETTMMRQLDRGISMLKDKLAKKKIKNESQLVLQELEGRIK 361
            :.:|:.:...||.|:.||:|.: |.:..::|:....|:.||.:|.|:.|            ||.|
Human   327 TLTTLRYANRAKNIKNKPRVNE-DPKDALLREFQEEIARLKAQLEKRSI------------GRRK 378

  Fly   362 RDMLKIVSSASLDDYRLQKRRRTWTLTASGSEGDAPVLALPEPEESR-------LPRPSKLTNLP 419
                           |.:|||..   ..||..|:.......|.||..       ..:..||....
Human   379 ---------------RREKRREG---GGSGGGGEEEEEEGEEGEEEGDDKDDYWREQQEKLEIEK 425

  Fly   420 KPLFQRRGIAPKAKGICKTLKEKRLQTDNMDTMPGRAKQLGRETASRIPSVMMSKK-----YQES 479
            :.:.:...:..:.|  .:.||||..:.:::......|:.||.:..:....:::..|     ..|.
Human   426 RAIVEDHSLVAEEK--MRLLKEKEKKMEDLRREKDAAEMLGAKIKAMESKLLVGGKNIVDHTNEQ 488

  Fly   480 VPNCDAPQTEISALTASNQVAKETIEKYEEQVKRLKETIERLEME----NGKAVNLGEQFETHKA 540
            ....:..:.||:......:..::.:|..:|:...||||...|:.|    ..|...|..:.:..||
Human   489 QKILEQKRQEIAEQKRREREIQQQMESRDEETLELKETYSSLQQEVDIKTKKLKKLFSKLQAVKA 553

  Fly   541 KSKQMEEELLSSISEKDSTIVSLQQSLEELSRDVLRNSKEDQMRSMCPELESSCERICNKCLELE 605
            :...::||.:....|       |:|:..||:|::..                       |.|.:|
Human   554 EIHDLQEEHIKERQE-------LEQTQNELTRELKL-----------------------KHLIIE 588

  Fly   606 RLLPLASASGLDSVACQFDQ 625
            ..:||...|.:.:.|. ||:
Human   589 NFIPLEEKSKIMNRAF-FDE 607

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canaNP_001027247.1 KISc 8..316 CDD:214526 124/339 (37%)
Motor_domain 8..310 CDD:277568 121/333 (36%)
SMC_prok_B <471..1270 CDD:274008 33/164 (20%)
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
KIF3BNP_004789.1 KISc_KIF3 8..340 CDD:276822 121/334 (36%)
Smc <352..>614 CDD:224117 63/319 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 374..412 14/67 (21%)
Globular 580..747 9/52 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 699..747
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.