DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cana and Klp54D

DIOPT Version :9

Sequence 1:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster
Sequence 2:NP_001303355.1 Gene:Klp54D / 47216 FlyBaseID:FBgn0263076 Length:760 Species:Drosophila melanogaster


Alignment Length:637 Identity:166/637 - (26%)
Similarity:280/637 - (43%) Gaps:135/637 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SIQVCIKVRPCE--------------PGLTSLWQVKEGRSIQLADSH----AEPYVFDYVFDEGA 54
            :|.|.::|||..              ||...:  :.||..:....||    ...:.::.||:.||
  Fly   166 NINVVVRVRPLNDKEKRDRHGSTLQFPGNGQV--ILEGNDVGQKRSHNRDSVRVFTYNVVFEPGA 228

  Fly    55 SNQEVFDRMA-KHIVHACMQGSNGTIFAYGQTSSGKTYTMMG------DEQNP-----GVMVLAA 107
            :.:::.|... |.|:...::|.:.|.|.||||.||||:|:.|      .:.||     |::..:.
  Fly   229 TQEDILDYSGIKRIIEMGIEGFSCTAFCYGQTGSGKTHTLTGPPDLFVGKPNPKDPRHGLIFRSF 293

  Fly   108 KEIFQQISSETERDFLLRVGYIEIYNEKIYDLLN----KKNQDLKIHESGNG-----IVNVNCKE 163
            ..:||.|.:..:.:::|:..::|||||::.||||    :|...::..:...|     :..|:|:|
  Fly   294 LYLFQLIKNRKDVNYVLKASFMEIYNERVIDLLNPGSARKPLAVRWSKKSGGFFVENLFTVDCEE 358

  Fly   164 SIVTSEDDLLRQLYMGNKERVVGETNMNERSSRSHAIFRIIIESRKSDHSDNDTVKQSVLSLVDL 228
            .     ||||..|..|.:.|.||...||:.|||||.|..:.|.|.:.........|...::.|||
  Fly   359 L-----DDLLAVLEEGMRNRAVGSHAMNDHSSRSHTILTVHILSDQQTDGGVFLSKHGKINFVDL 418

  Fly   229 AGSE----------QVDPADHAS-SLMIFRNLVKSLSESVDSKPNS----FRDSKLPRIMLPSLG 278
            ||||          .::.|::.: |||:....:.|||   |||..:    :|||:|.:::..||.
  Fly   419 AGSELTKKTMSEGKTLEEANNINKSLMVLGYCISSLS---DSKKRTGHIPYRDSQLTKLLADSLA 480

  Fly   279 GNVLTSIICTITPSFVE--ESSSTISFGTCAKKIRCKPQVCKIDSETTMMRQLDRGISMLKDKLA 341
            ||.:|.:|..::|:...  |:.:|:.:.:.||:||.|| |.|:|....::..|.|.|..|  ::.
  Fly   481 GNGVTLMIACVSPAHYNHAETLNTLRYASRAKRIRTKP-VIKMDPREALILSLKRDIHAL--QME 542

  Fly   342 KKKIKNESQLVLQEL-EGRIKRDMLKIVSSASLDDYRLQKRRRTWTLTASGSEGDAPVLALPEPE 405
            ...:|....|..|.. .|....::|::                  .|....|.|..||   |:.:
  Fly   543 NDHLKAALNLHHQAAPNGGPVENLLEL------------------QLDRVSSGGGVPV---PKVD 586

  Fly   406 ESRLPR--PSKLTNLPK--------------PLFQ-RRGIAPKAKGICKTLKE--KRLQTDN--- 448
            ..|||.  .|:|..|.|              .||. |..|....:.:|:..:.  |:|:..|   
  Fly   587 LQRLPELDGSELAELVKLYMVENESLRQENNHLFTVRETILRDQEIVCRENERLLKKLEDVNKVC 651

  Fly   449 -----MDTMPGRAKQLGRETASRIPSVMMSKKYQESVPNCDAPQTEISALTASNQVAKETIEKYE 508
                 :...|..:...|:||..  ..:..:.:..:|.|..|.|..:..:..|:.:.  :|.:|..
  Fly   652 VRSPLIPARPAISPTTGKETPG--TEIWTNPEPLQSPPGPDLPIEQRMSENANRRT--DTAQKRI 712

  Fly   509 EQVKRLKETIERLEMENG---------KAVNLGEQFETHKAKSKQMEEELLS 551
            :| ||:.:.|  |.|.|.         |.:||..: |.|..:|.:...::|:
  Fly   713 DQ-KRIAKNI--LIMANAFRKPDSDITKELNLNPE-EAHAKQSTEFMPDMLT 760

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canaNP_001027247.1 KISc 8..316 CDD:214526 108/363 (30%)
Motor_domain 8..310 CDD:277568 104/357 (29%)
SMC_prok_B <471..1270 CDD:274008 21/90 (23%)
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
Klp54DNP_001303355.1 KISc 166..520 CDD:214526 108/364 (30%)
KISc 166..512 CDD:276812 102/355 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437891
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.