DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cana and ncd

DIOPT Version :9

Sequence 1:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster
Sequence 2:NP_001287592.1 Gene:ncd / 43517 FlyBaseID:FBgn0002924 Length:700 Species:Drosophila melanogaster


Alignment Length:332 Identity:97/332 - (29%)
Similarity:162/332 - (48%) Gaps:34/332 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SIQVCIKVRPC----EPGLTSLWQVKEGRSIQLADSHAEP--------YVFDYVFDEGASNQEVF 60
            :|:|..::||.    |..:...|...:..:::|....|:.        :.||.||...:|..::|
  Fly   348 NIRVFCRIRPPLESEENRMCCTWTYHDESTVELQSIDAQAKSKMGQQIFSFDQVFHPLSSQSDIF 412

  Fly    61 DRMAKHIVHACMQGSNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER--DFL 123
            : |...::.:.:.|.|..|||||||.|||||||.|..::.||:......:|..|......  ::.
  Fly   413 E-MVSPLIQSALDGYNICIFAYGQTGSGKTYTMDGVPESVGVIPRTVDLLFDSIRGYRNLGWEYE 476

  Fly   124 LRVGYIEIYNEKIYDLLNKKNQDLKIH---ESGNGIVNVNCKESIVTSEDDLLRQLYMGNKERVV 185
            ::..::|||||.:||||:.:.:|::|.   .:.|.|...|..|..|...:.|...::.....|..
  Fly   477 IKATFLEIYNEVLYDLLSNEQKDMEIRMAKNNKNDIYVSNITEETVLDPNHLRHLMHTAKMNRAT 541

  Fly   186 GETNMNERSSRSHAIFRIIIESRKSDHSDNDTVKQSVLSLVDLAGSEQVDPADHAS-------SL 243
            ..|..|||||||||:.::.:..|   |::...:....::||||||||....:...:       ||
  Fly   542 ASTAGNERSSRSHAVTKLELIGR---HAEKQEISVGSINLVDLAGSESPKTSTRMTETKNINRSL 603

  Fly   244 MIFRNLVKSLSESVDSKPNSFRDSKLPRIMLPSLGGNVLTSIICTITP--SFVEESSSTISFGTC 306
            ....|::.:|.:..|..|  :|:|||..:::||||||..|.:...::|  ...:||..::.|...
  Fly   604 SELTNVILALLQKQDHIP--YRNSKLTHLLMPSLGGNSKTLMFINVSPFQDCFQESVKSLRFAAS 666

  Fly   307 AKKIRCK 313
            ...  ||
  Fly   667 VNS--CK 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canaNP_001027247.1 KISc 8..316 CDD:214526 97/332 (29%)
Motor_domain 8..310 CDD:277568 95/327 (29%)
SMC_prok_B <471..1270 CDD:274008
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
ncdNP_001287592.1 KISc_C_terminal 346..672 CDD:276817 97/332 (29%)
KISc 348..678 CDD:214526 97/332 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437979
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.