DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cana and Klp59D

DIOPT Version :9

Sequence 1:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster
Sequence 2:NP_611762.1 Gene:Klp59D / 37674 FlyBaseID:FBgn0034827 Length:729 Species:Drosophila melanogaster


Alignment Length:591 Identity:148/591 - (25%)
Similarity:244/591 - (41%) Gaps:147/591 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NASSIQ---VCIKVRPCEPGLTSLWQVKEGRSIQL-------ADS----------------HAEP 43
            |..::|   ||::.||...        ||..|..|       |||                ....
  Fly   227 NGGTVQQITVCVRKRPMSR--------KEENSKNLDIITVPSADSLIVHELRLKVDLTKFLEHHK 283

  Fly    44 YVFDYVFDEGASNQEVFDRMAKHIVHACMQGSNGTIFAYGQTSSGKTYTMMGD------EQNPGV 102
            :.|||.|||..||..|:|..|:.::....:|.|.|.||||||.||||:||.|:      :...|:
  Fly   284 FRFDYTFDEECSNALVYDHTARPLIRTMFEGGNATCFAYGQTGSGKTHTMGGEFFGKVQDCGTGI 348

  Fly   103 MVLAAKEIFQQISSETERDFLLRV--GYIEIYNEKIYDLLNKKNQDLKIHESG-NGIVNVNCKES 164
            ..:||:::|:::|....|....::  .:.|||..|::|||......|::.|.. ..:|.|...|.
  Fly   349 YAMAARDVFEEVSRPEYRQMGAKITCSFFEIYGTKVFDLLLPNKPMLRVLEDARQQVVVVGLTEM 413

  Fly   165 IVTSEDDLLRQLYMGNKERVVGETNMNERSSRSHAIFRIIIESRKSDHSDNDTVKQSVLSLVDLA 229
            .||..:|:||.:..|:|||..|:|:.|.:||||||:|:|.:      |..:........|.||||
  Fly   414 PVTKVEDVLRLIEHGSKERTSGQTSANAKSSRSHAVFQIAL------HFPDSWGPHGKCSFVDLA 472

  Fly   230 GSE------------QVDPADHASSLMIFRNLVKSLSESVDSKPNSFRDSKLPRIMLPS-LGGNV 281
            |:|            :::.|:...||:..:..:::||......|  ||.|||.:::..| :||..
  Fly   473 GNERGADTQSADRQTRIEGAEINKSLLALKECIRALSRQSSHLP--FRGSKLTQVLRDSFVGGKK 535

  Fly   282 -LTSIICTITPSFVEESSSTISFGTCAKKIRCKPQVCKIDSETTMMRQLDRGISMLKDKLAKKKI 345
             .|.:|..|:||.           :|            :::....:|..||    :|:.:||:  
  Fly   536 NKTCMIAMISPSM-----------SC------------VENTLNTLRYADR----VKELIAKE-- 571

  Fly   346 KNESQLVLQELEGRIKRDMLKIVSSASLDDYRLQKRRRTWTLTASGSEGDAPVLALPEPEESR-- 408
              :..|...|.:|....|:.:......:.|                .|||..    ||.|:::  
  Fly   572 --DEHLQSVEGDGEKSPDLNEESEPEMMAD----------------EEGDEE----PEDEDNQHL 614

  Fly   409 ---LPRPSKLTNLPKPLFQRRG---IAPKAK-GICKTLKEKRLQTDNMDTMPGRAKQLGRETASR 466
               ....|...|:...:.....   :.|... .|.:..::..|..:|::|.....:||..:    
  Fly   615 TISSEEASSYNNMSYDMSFNHTLNILGPSRNVDIQEVAEQHALLVENLETYAHNFRQLKTD---- 675

  Fly   467 IPSVMMSKKYQESVPNCDAPQTEISALTASNQVAKETIEKYEEQVKRLKETIERLEMENGKAVNL 531
                   |:.::...|.::...::.|:.  |: .::....|..| |.|||       ||..|...
  Fly   676 -------KEIEQYTQNSESALMKLLAMV--NR-TRDVTHNYNTQ-KLLKE-------ENQNAYKK 722

  Fly   532 GEQFET 537
            ||..|:
  Fly   723 GELDES 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canaNP_001027247.1 KISc 8..316 CDD:214526 105/356 (29%)
Motor_domain 8..310 CDD:277568 105/350 (30%)
SMC_prok_B <471..1270 CDD:274008 16/67 (24%)
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
Klp59DNP_611762.1 KISc_KIF2_like 233..565 CDD:276818 107/374 (29%)
Kinesin 239..566 CDD:278646 105/369 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437834
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.