DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cana and Klp59C

DIOPT Version :9

Sequence 1:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster
Sequence 2:NP_611759.1 Gene:Klp59C / 37671 FlyBaseID:FBgn0034824 Length:626 Species:Drosophila melanogaster


Alignment Length:492 Identity:134/492 - (27%)
Similarity:218/492 - (44%) Gaps:107/492 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NASSIQVCIKVRPC--------EPGLTSL-----WQVKEGRS----IQLADSHAEPYVFDYVFDE 52
            |...|.||::.||.        |..:.|:     ..|.|.|.    ::..::|:  :.|||||||
  Fly   184 NCHQIMVCVRKRPLRRKELADREQDVVSIPSKHTLVVHEPRKHVNLVKFLENHS--FRFDYVFDE 246

  Fly    53 GASNQEVFDRMAKHIVHACMQGSNGTIFAYGQTSSGKTYTMMGDEQNP--------GVMVLAAKE 109
            ..||..|::..|:.::.....|...|.||||||.|||||||.|  |.|        |:..:|||:
  Fly   247 ECSNATVYEFTARPLIKHIFDGGMATCFAYGQTGSGKTYTMGG--QFPGRHQSSMDGIYAMAAKD 309

  Fly   110 IFQQISSETERDFLLRV--GYIEIYNEKIYDLLNKKNQDLKIHESGNGIVN-VNCKESIVTSEDD 171
            :|..:.:.......|:|  .:.|||..:::|||......|::.|..|..|. |...::.|.:..:
  Fly   310 VFSTLKTVPYNKLNLKVYCSFFEIYGTRVFDLLMPGKPQLRVLEDRNQQVQVVGLTQNPVQNTAE 374

  Fly   172 LLRQLYMGNKERVVGETNMNERSSRSHAIFRIIIESRKSD--HSDNDTVKQSVLSLVDLAGSEQV 234
            :|..|.:||..|..|.|:.|.:||||||:|:|::.|...:  |..        .||:||||:|: 
  Fly   375 VLDLLELGNSVRTSGHTSANSKSSRSHAVFQIVLRSAAGEKLHGK--------FSLIDLAGNER- 430

  Fly   235 DPADHAS--------------SLMIFRNLVKSLSESVDSKPNSFRDSKLPRIMLPS-LGG-NVLT 283
             .||::|              ||::.:..:::|.......|  ||.|||.:::..| :|| .|.|
  Fly   431 -GADNSSADRQTRLEGSEINKSLLVLKECIRALGRQSSHLP--FRGSKLTQVLRDSFIGGKKVKT 492

  Fly   284 SIICTITPSF--VEESSSTISFGTCAKKIRCKPQVCKIDSETTMMRQLDRGISMLKDKLAKKKIK 346
            .:|..|:|..  ||.:.:|:.:....|::    .|..|.|:  .|...:.|.:.:.|        
  Fly   493 CMIAMISPCLHSVEHTLNTLRYADRVKEL----SVESIPSK--RMPDANLGSTSMSD-------- 543

  Fly   347 NESQLVLQELEGRIKRDMLKIVSSASLDDYRLQKRRRTWTLTASGSEGDAPVLALPEPEESRLPR 411
                :|.|....|    :....||.|:.....|.::.|.|..                :.:|..:
  Fly   544 ----IVCQSSTQR----LFPCASSTSMPGGGNQAQQHTNTAN----------------DLNRSQK 584

  Fly   412 PSKLTNLP---KPLFQRRGIAPKAKG--ICKTLKEKR 443
            |:.....|   :.|.||:|.:.:...  :.|:|.:.|
  Fly   585 PTSKPTYPTSGQQLVQRKGSSQREASMMLTKSLAQFR 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canaNP_001027247.1 KISc 8..316 CDD:214526 108/355 (30%)
Motor_domain 8..310 CDD:277568 108/349 (31%)
SMC_prok_B <471..1270 CDD:274008
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
Klp59CNP_611759.1 KISc_KIF2_like 187..519 CDD:276818 107/347 (31%)
Kinesin 193..520 CDD:278646 104/342 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437836
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.