DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cana and nod

DIOPT Version :9

Sequence 1:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster
Sequence 2:NP_001285129.1 Gene:nod / 32107 FlyBaseID:FBgn0002948 Length:666 Species:Drosophila melanogaster


Alignment Length:704 Identity:166/704 - (23%)
Similarity:275/704 - (39%) Gaps:168/704 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTKNASSIQVCIKVRPC-------EPGLTSLWQVKEGRSIQLADSHAEPYVFDYVFDEGASNQE 58
            |.....|::::.::..|.       ||.:.......:|:|: :.|.:  .:.||:.|....|..|
  Fly     1 MEGAKLSAVRIAVREAPYRQFLGRREPSVVQFPPWSDGKSL-IVDQN--EFHFDHAFPATISQDE 62

  Fly    59 VFDRMAKHIVHACMQGSNGTIFAYGQTSSGKTYTM----MGD--EQNPGVMVLAAKEIFQQISS- 116
            ::..:...:|...::|...|..|||||.:||:|:|    .|:  .::.|::..|..:||::::: 
  Fly    63 MYQALILPLVDKLLEGFQCTALAYGQTGTGKSYSMGMTPPGEILPEHLGILPRALGDIFERVTAR 127

  Fly   117 -ETERDFL-LRVGYIEIYNEKIYDLLNKKNQDLKIHESGNGIVNVNCKESI---VTSEDDLLRQL 176
             |..:|.: :...:|||||||.:|||.....        ..:|...|:...   :.|:.||...|
  Fly   128 QENNKDAIQVYASFIEIYNEKPFDLLGSTPH--------MPMVAARCQRCTCLPLHSQADLHHIL 184

  Fly   177 YMGNKERVVGETNMNERSSRSHAIFRIIIESRKSDHSDNDTVKQSVLSLVDLAGSEQVDPADHAS 241
            .:|.:.|.|..||||..|||||||..|.::| |:.||.        :::|||||||.|....|..
  Fly   185 ELGTRNRRVRPTNMNSNSSRSHAIVTIHVKS-KTHHSR--------MNIVDLAGSEGVRRTGHEG 240

  Fly   242 -----------SLMIFRNLVKSLSESVDSKPNSFRDSKLPRIMLPSLGGNVLTSIICTITP--SF 293
                       .|:....:|.|::......|  :|||.|..::..||......:.:..|:|  ..
  Fly   241 VARQEGVNINLGLLSINKVVMSMAAGHTVIP--YRDSVLTTVLQASLTAQSYLTFLACISPHQCD 303

  Fly   294 VEESSSTISFGTCAKKIRCKP-QVCK----IDSETT-MMRQLDRGISMLKDKLAKKKIKNESQLV 352
            :.|:.||:.|||.|||:|..| ||.:    :.:.|| :.||     ::......|....|.:.:|
  Fly   304 LSETLSTLRFGTSAKKLRLNPMQVARQKQSLAARTTHVFRQ-----ALCTSTAIKSNAANHNSIV 363

  Fly   353 LQELEGRIKRDMLKIVSSASLDDYRLQKRRRTWTLTASGSEGDAPVLALPEPEESRLPRPS---- 413
            :.    :.|....|.:|:.      |.:.|....:|....:....:|.|   ||:.|...|    
  Fly   364 VP----KSKYSTTKPLSAV------LHRTRSELGMTPKAKKRARELLEL---EETTLELSSIHIQ 415

  Fly   414 ----KLTNLPKPLFQRRGIAPKAKGICKTLKEKRLQTDNMDTMPGRAKQLGRETASRIPSVMMSK 474
                .|........:.|.:.|...|     :|.|..:....|:.|..::...:.:|::...|::.
  Fly   416 DSSLSLLGFHSDSDKDRHLMPPPTG-----QEPRQASSQNSTLMGIVEETEPKESSKVQQSMVAP 475

  Fly   475 KYQESVPNCDAPQTEISALTASNQVAKETIEKYEEQVKRLKETIERLEMENGKAVNLGEQFETHK 539
            ....:| .|....|.||.::.                                           :
  Fly   476 TVPTTV-RCQLFNTTISPISL-------------------------------------------R 496

  Fly   540 AKSKQMEEELLSSISEKDSTIV-SLQQSLEELSRDV-LRNSKEDQMRSMCPELESSCERICNKCL 602
            |.|.|.|   ||.|...:.|:| |.||..  |.|.| |.:|...|.....|           |.:
  Fly   497 ASSSQRE---LSGIQPMEETVVASPQQPC--LRRSVRLASSMRSQNYGAIP-----------KVM 545

  Fly   603 ELERLLPLASASGLDSVACQFDQLRSEIAATRMKLESMLSTFSHASCEVSQKTT 656
            .|.|...||.             :|..  ||.:.:::......|....|.:|.|
  Fly   546 NLRRSTRLAG-------------IREH--ATSVVVKNETDAIPHLRSTVQKKRT 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canaNP_001027247.1 KISc 8..316 CDD:214526 97/340 (29%)
Motor_domain 8..310 CDD:277568 94/333 (28%)
SMC_prok_B <471..1270 CDD:274008 37/188 (20%)
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
nodNP_001285129.1 KISc 8..325 CDD:214526 96/338 (28%)
KISc 8..318 CDD:276812 92/331 (28%)
ComEA 540..648 CDD:224472 13/71 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45437928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.