DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment cana and Kif22

DIOPT Version :9

Sequence 1:NP_001027247.1 Gene:cana / 3771934 FlyBaseID:FBgn0040233 Length:1931 Species:Drosophila melanogaster
Sequence 2:XP_006507264.1 Gene:Kif22 / 110033 MGIID:109233 Length:690 Species:Mus musculus


Alignment Length:682 Identity:157/682 - (23%)
Similarity:282/682 - (41%) Gaps:159/682 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IQVCIKVRPCEPGLTSLWQVKEGRSIQLADS------------HAEPYVFDYVFDEGASNQEVFD 61
            ::|.:::||...|.|   :.||...::..||            ....|.||..:.|.::.|||:.
Mouse    39 VRVAVRLRPFMDGET---EAKELPCVRAIDSCSLEVANWKKYQETLKYQFDAFYGEKSTQQEVYV 100

  Fly    62 RMAKHIVHACMQGSNGTIFAYGQTSSGKTYTMMGDEQNPGVMVLAAKEIFQQISSETER----DF 122
            ...:.|:...::|.|.::.|||.|.:|||:||:|..:.|||:..|..::.|....|:..    |.
Mouse   101 GSVQPILRHLLEGQNASVLAYGPTGAGKTHTMLGSPEQPGVIPRALMDLLQLAREESAEGRPWDV 165

  Fly   123 LLRVGYIEIYNEKIYDLLNKKNQDLKIHESGNG-IVNVNCKESIVTSEDDLLRQLYMGNKERVVG 186
            .:.:.|:|||.||:.|||:..:.||.|.|...| |:.....:..:||..|..:.....::.|.||
Mouse   166 SVAMSYLEIYQEKVLDLLDPASGDLVIREDCRGNILIPGLTQKPITSFSDFEQHFLPASRNRAVG 230

  Fly   187 ETNMNERSSRSHAIFRIIIESRKSDHSDNDTVKQSVLSLVDLAGSEQ-----------VDPADHA 240
            .|.:|:|||||||:..:.::.|  :.......::..|.|:||||||.           .:.....
Mouse   231 ATRLNQRSSRSHAVLLVKVDQR--ERLTPFRQREGKLYLIDLAGSEDNRRTGNQGIRLKESGAIN 293

  Fly   241 SSLMIFRNLVKSLSESVDSKPNSFRDSKLPRIMLPSLGGNVLTSIICTITPS--FVEESSSTISF 303
            :||.:...:|.:|::.:...|  :|||||.|::..||||:..:.:|..|.|.  |.:::.|.::|
Mouse   294 TSLFVLGKVVDALNQGLPRIP--YRDSKLTRLLQDSLGGSAHSILIANIAPERRFYQDTISALNF 356

  Fly   304 GTCAKKIRCKPQVCKIDSETTMMRQLDRGISMLKDKLAKKKIKNESQL----------------- 351
            ...:|::..:|    ..:|:....      ::...||::|::...|:.                 
Mouse   357 TARSKEVINRP----FTNESLQPH------ALAPVKLSQKELLGPSEAKKAKGPEEESTGSPEST 411

  Fly   352 -----------VLQELEGRIKRDMLKIVSSASLDDYRLQKRRRTWTLTASGSEGDAPVLALPEPE 405
                       :||:|..         :..|.|::....:|    .|.:.||:| .|:|..|:.|
Mouse   412 AAPASASQKLSLLQKLSN---------MDPAMLENLLSMER----LLGSQGSQG-TPLLNTPKRE 462

  Fly   406 ESRLPRPSKLTNLPKPLFQRRGIAPKAKGICKTLKEKRLQTD--NMDTMPGRAKQLGRETASRIP 468
            ...|                          .||::||.|:.:  .|......||.|.:|..    
Mouse   463 RMVL--------------------------MKTVEEKNLEIERLKMKQKELEAKVLAQEAP---- 497

  Fly   469 SVMMSKKYQESVPNCDAPQTEISALTASNQVAKETIEKYEEQVKRLKETIERLEMENGKAVNLGE 533
                ..:.:|:.|....|....|...|  :..|:.:....:::::.:|:..::::          
Mouse   498 ----DPREKENTPTILQPPASYSGTVA--KPLKKAVVMPLQRIQKQRESSNQIQL---------- 546

  Fly   534 QFETHKAKSKQMEEELLSSISEKDSTIVSLQQSLEELSR------DVLRNSKEDQMRSMCPELES 592
               ..|...:::|....|...|||.....:|.|.|.|:.      |:|......::||:      
Mouse   547 ---LKKGPKRKLEPSPESEAVEKDEDYWEVQISPELLAHGRKKLLDLLNEGSARELRSL------ 602

  Fly   593 SCERICNKCLEL-----ERLLPLASASGLDSV 619
              :||..|..:|     |...|.:....|:.|
Mouse   603 --QRIGQKKAQLIVGWRELHGPFSEVEDLEQV 632

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
canaNP_001027247.1 KISc 8..316 CDD:214526 98/336 (29%)
Motor_domain 8..310 CDD:277568 97/330 (29%)
SMC_prok_B <471..1270 CDD:274008 29/160 (18%)
Mplasa_alph_rch 924..1647 CDD:275316
CENP-H 1204..>1266 CDD:283493
CALCOCO1 <1489..1850 CDD:285171
Kif22XP_006507264.1 KISc_KID_like 38..361 CDD:276827 96/328 (29%)
ComEA <591..641 CDD:393460 11/50 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0242
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.