DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33702 and CG13561

DIOPT Version :9

Sequence 1:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_611830.3 Gene:CG13561 / 37765 FlyBaseID:FBgn0034906 Length:176 Species:Drosophila melanogaster


Alignment Length:161 Identity:46/161 - (28%)
Similarity:72/161 - (44%) Gaps:20/161 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ITNVFLTIILFSSTLGAHF-------RFTNFKCISLDPEFAVVKECILKMVRRSVVGINFHIAIK 63
            :|.:||...|:      |.       :|||.:|:|.|..|..|..|.|..|:|.||.::....| 
  Fly     4 LTELFLLFGLW------HILQVQGVAKFTNIECLSADENFTTVSLCRLYAVKRDVVEMSLRANI- 61

  Fly    64 YSQPINKIEFNLSIFRKSNMYRLFLVN-HTIDFCYYMRRPEQYPIFYMFHDSLMAATNANHSCPY 127
            ...|...:...:.:.:|::.|:.||.| ...|.|.|:.: ..:|...:...|....||.| .|| 
  Fly    62 LRWPKGPVSMRMQLLKKASGYKPFLYNICQSDVCEYLEK-RNHPFINIILSSFGNRTNVN-KCP- 123

  Fly   128 TEKDIYVKKMTFNDKTLKDLLSFLPVGEYKL 158
            ...:|.::...|..|.| |::. ||.|:|.|
  Fly   124 IPPEIVLEHFRFPVKVL-DMMP-LPFGDYGL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 24/85 (28%)
CG13561NP_611830.3 DM8 82..173 CDD:214778 24/76 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472438
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.