DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33702 and CG33757

DIOPT Version :10

Sequence 1:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027398.1 Gene:CG33757 / 3772602 FlyBaseID:FBgn0053757 Length:178 Species:Drosophila melanogaster


Alignment Length:60 Identity:16/60 - (26%)
Similarity:25/60 - (41%) Gaps:9/60 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 YKVVR-------VDLKEPSSWTDVIAEHEKDVLSTASAVNGDQLVVSYMSDVKHILQIRD 379
            ||.||       |:.|:|...|.  .:..:|:..:...:..|.||...|:...|...||:
  Fly   154 YKYVRLRCRQTGVESKKPVPLTS--NKQVEDLFGSIGMLCVDDLVHEIMTVGPHFDAIRE 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33702NP_001027120.1 DUF1091 73..158 CDD:461928
CG33757NP_001027398.1 DUF1091 67..152 CDD:461928
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.