DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33702 and CG33723

DIOPT Version :9

Sequence 1:NP_001027120.1 Gene:CG33702 / 3771932 FlyBaseID:FBgn0053702 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001027235.1 Gene:CG33723 / 3772451 FlyBaseID:FBgn0053723 Length:180 Species:Drosophila melanogaster


Alignment Length:172 Identity:54/172 - (31%)
Similarity:91/172 - (52%) Gaps:11/172 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LTIILFSSTLGAHFRFTNFKCISLDPEFAVVKECILKMVRRSVVGINFHIAIKYSQPINKIEFNL 75
            |.::|....:.....|||.||.|::.:||...:|.||.:.|:...|:..::: :..||.|...|.
  Fly    13 LLLMLIVKEIKPRVEFTNLKCRSVNKDFAEFTQCTLKSINRTYKYISTKVSL-HKLPITKARVNF 76

  Fly    76 SIFRKSNMYRLFLVNHTIDFCYYMRRPEQYPIFYMFHDSLMAATNANHSCPYTEKDIYVKKM--- 137
            .::::.|.||.||.|.|:|.|::.:..:..|:...|.|.:...:|.|||||| ..||.|:|:   
  Fly    77 GLYKRFNGYRPFLYNKTLDACHFFQHQKANPVAKYFFDMIKEYSNLNHSCPY-NNDIIVEKVSTD 140

  Fly   138 TFNDKTLKDLLSFLPVGEYKL----VVSVGAFGVWRLQVNLF 175
            |.|....| :|.: |.|:|.|    :::....||.::.:.||
  Fly   141 TVNHHVTK-ILPY-PEGDYMLETHWMLNDIYCGVIQVYITLF 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33702NP_001027120.1 DUF1091 73..158 CDD:284008 31/87 (36%)
CG33723NP_001027235.1 DUF1091 74..159 CDD:284008 31/87 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472243
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.